| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (18 species) |
| Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51863] (13 PDB entries) |
| Domain d1t25a1: 1t25 A:18-163 [99071] Other proteins in same PDB: d1t25a2 complexed with gag, gol, nai |
PDB Entry: 1t25 (more details), 1.9 Å
SCOPe Domain Sequences for d1t25a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t25a1 c.2.1.5 (A:18-163) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
iivvtnpvdvmvqllhqhsgvpknkiigl
Timeline for d1t25a1: