SCOPe 2.07: Domain d1szxa2: 1szx A:84-198

Lineage for d1szxa2 (1szx A:84-198)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)

8. Domain d1szxa2: 1szx A:84-198 [99050]
   Other proteins in same PDB: d1szxa1, d1szxb1
   complexed with mn

Details for d1szxa2

PDB Entry: 1szx, 1.95 Å

PDB Description: role of hydrogen bonding in the active site of human manganese superoxide dismutase

PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1szxa2:

Sequence; same for both SEQRES and ATOM records:

>d1szxa2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgfgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1szxa2:

• d1szxa2 first appeared in SCOP 1.67
  
• d1szxa2 appears in SCOPe 2.06
  
• d1szxa2 appears in the current release, SCOPe 2.08