Lineage for d1szxa1 (1szx A:1-83)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303638Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2303702Species Human (Homo sapiens) [TaxId:9606] [46619] (35 PDB entries)
  8. 2303727Domain d1szxa1: 1szx A:1-83 [99049]
    Other proteins in same PDB: d1szxa2, d1szxb2
    complexed with mn

Details for d1szxa1

PDB Entry: 1szx (more details), 1.95 Å

PDB Description: role of hydrogen bonding in the active site of human manganese superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1szxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szxa1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d1szxa1:

Click to download the PDB-style file with coordinates for d1szxa1.
(The format of our PDB-style files is described here.)

Timeline for d1szxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szxa2