Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein Hypothetical protein DR1025 [103209] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries) |
Domain d1sz3b_: 1sz3 B: [99043] complexed with gnp, mg |
PDB Entry: 1sz3 (more details), 1.6 Å
SCOPe Domain Sequences for d1sz3b_:
Sequence, based on SEQRES records: (download)
>d1sz3b_ d.113.1.1 (B:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas fvsredfaqlyaagqirmyqtklfyadalrekgfpalp
>d1sz3b_ d.113.1.1 (B:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} mehderthvpvelraagvvllnergdillvqekgipekaglwhipsgavedgenpqdaav reaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvs redfaqlyaagqirmyqtklfyadalrekgfpalp
Timeline for d1sz3b_: