SCOPe 2.08: Domain d1sz3b_: 1sz3 B:

Lineage for d1sz3b_ (1sz3 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Hypothetical protein DR1025 [103209] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries)

8. Domain d1sz3b_: 1sz3 B: [99043]
   complexed with gnp, mg

Details for d1sz3b_

PDB Entry: 1sz3, 1.6 Å

PDB Description: crystal structure of nudix hydrolase dr1025 in complexed with gnp and mg+2

PDB Compounds: (B:) MutT/nudix family protein

SCOPe Domain Sequences for d1sz3b_:

Sequence, based on SEQRES records:

>d1sz3b_ d.113.1.1 (B:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
fvsredfaqlyaagqirmyqtklfyadalrekgfpalp

Sequence, based on observed residues (ATOM records):

>d1sz3b_ d.113.1.1 (B:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
mehderthvpvelraagvvllnergdillvqekgipekaglwhipsgavedgenpqdaav
reaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvs
redfaqlyaagqirmyqtklfyadalrekgfpalp

Timeline for d1sz3b_:

• d1sz3b_ first appeared in SCOP 1.67
  
• d1sz3b_ appears in SCOPe 2.07