Lineage for d1sz3b_ (1sz3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971556Protein Hypothetical protein DR1025 [103209] (1 species)
  7. 2971557Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries)
  8. 2971560Domain d1sz3b_: 1sz3 B: [99043]
    complexed with gnp, mg

Details for d1sz3b_

PDB Entry: 1sz3 (more details), 1.6 Å

PDB Description: crystal structure of nudix hydrolase dr1025 in complexed with gnp and mg+2
PDB Compounds: (B:) MutT/nudix family protein

SCOPe Domain Sequences for d1sz3b_:

Sequence, based on SEQRES records: (download)

>d1sz3b_ d.113.1.1 (B:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
mehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqd
aavreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeas
fvsredfaqlyaagqirmyqtklfyadalrekgfpalp

Sequence, based on observed residues (ATOM records): (download)

>d1sz3b_ d.113.1.1 (B:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
mehderthvpvelraagvvllnergdillvqekgipekaglwhipsgavedgenpqdaav
reaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvs
redfaqlyaagqirmyqtklfyadalrekgfpalp

SCOPe Domain Coordinates for d1sz3b_:

Click to download the PDB-style file with coordinates for d1sz3b_.
(The format of our PDB-style files is described here.)

Timeline for d1sz3b_: