Lineage for d1sx5a_ (1sx5 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604212Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 1604213Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 1604214Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 1604215Domain d1sx5a_: 1sx5 A: [99023]
    protein/DNA complex; complexed with mn

Details for d1sx5a_

PDB Entry: 1sx5 (more details), 1.5 Å

PDB Description: k38a ecorv bound to cleaved dna and mn2+: p1 crystal form
PDB Compounds: (A:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1sx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sx5a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtavlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

SCOPe Domain Coordinates for d1sx5a_:

Click to download the PDB-style file with coordinates for d1sx5a_.
(The format of our PDB-style files is described here.)

Timeline for d1sx5a_: