SCOPe 2.05: Domain d1sx5a_: 1sx5 A:

Lineage for d1sx5a_ (1sx5 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
   automatically mapped to Pfam PF09233

6. Protein Restriction endonuclease EcoRV [52985] (1 species)

7. Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)

8. Domain d1sx5a_: 1sx5 A: [99023]
   protein/DNA complex; complexed with mn

Details for d1sx5a_

PDB Entry: 1sx5, 1.5 Å

PDB Description: k38a ecorv bound to cleaved dna and mn2+: p1 crystal form

PDB Compounds: (A:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d1sx5a_:

Sequence; same for both SEQRES and ATOM records:

>d1sx5a_ c.52.1.2 (A:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtavlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Timeline for d1sx5a_:

• d1sx5a_ first appeared in SCOP 1.67
  
• d1sx5a_ appears in SCOPe 2.04
  
• d1sx5a_ appears in SCOPe 2.06
  
• d1sx5a_ appears in the current release, SCOPe 2.08