Lineage for d1st4b2 (1st4 B:40-145)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614505Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 2614506Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 2614507Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein)
  6. 2614508Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species)
  7. 2614509Species Human (Homo sapiens) [TaxId:9606] [102863] (5 PDB entries)
  8. 2614513Domain d1st4b2: 1st4 B:40-145 [98986]
    Other proteins in same PDB: d1st4a1, d1st4b1
    complexed with gta, yt3

Details for d1st4b2

PDB Entry: 1st4 (more details), 2.02 Å

PDB Description: structure of dcps bound to m7gpppa
PDB Compounds: (B:) mRNA decapping enzyme

SCOPe Domain Sequences for d1st4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st4b2 d.246.1.1 (B:40-145) mRNA decapping enzyme DcpS N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaqllt
gspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylr

SCOPe Domain Coordinates for d1st4b2:

Click to download the PDB-style file with coordinates for d1st4b2.
(The format of our PDB-style files is described here.)

Timeline for d1st4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1st4b1