SCOPe 2.07: Domain d1st4b1: 1st4 B:146-336

Lineage for d1st4b1 (1st4 B:146-336)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)

6. Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries)

8. Domain d1st4b1: 1st4 B:146-336 [98985]
   Other proteins in same PDB: d1st4a2, d1st4b2
   complexed with gta, yt3

Details for d1st4b1

PDB Entry: 1st4, 2.02 Å

PDB Description: structure of dcps bound to m7gpppa

PDB Compounds: (B:) mRNA decapping enzyme

SCOPe Domain Sequences for d1st4b1:

Sequence; same for both SEQRES and ATOM records:

>d1st4b1 d.13.1.3 (B:146-336) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlnvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

Timeline for d1st4b1:

• d1st4b1 first appeared in SCOP 1.67
  
• d1st4b1 appears in SCOPe 2.06
  
• d1st4b1 appears in the current release, SCOPe 2.08