Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins) |
Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102747] (5 PDB entries) |
Domain d1st4b1: 1st4 B:146-336 [98985] Other proteins in same PDB: d1st4a2, d1st4b2 complexed with gta, yt3 |
PDB Entry: 1st4 (more details), 2.02 Å
SCOPe Domain Sequences for d1st4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1st4b1 d.13.1.3 (B:146-336) mRNA decapping enzyme DcpS C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv ylhylpsyyhlnvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd pllkllqeaqq
Timeline for d1st4b1: