SCOPe 2.04: Domain d1soia_: 1soi A:

Lineage for d1soia_ (1soi A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Hypothetical protein DR1025 [103209] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries)

8. Domain d1soia_: 1soi A: [98941]
   complexed with sm

Details for d1soia_

PDB Entry: 1soi, 1.8 Å

PDB Description: crystal structure of nudix hydrolase dr1025 in complex with sm+3

PDB Compounds: (A:) MutT/nudix family protein

SCOPe Domain Sequences for d1soia_:

Sequence, based on SEQRES records:

>d1soia_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
ehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqda
avreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasf
vsredfaqlyaagqirmyqtklfyadalrekgfpalpv

Sequence, based on observed residues (ATOM records):

>d1soia_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
ehderthvpvelraagvvllnergdillvqekgihpekaglwhipsgavedgenpqdaav
reaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvs
redfaqlyaagqirmyqtklfyadalrekgfpalpv

Timeline for d1soia_:

• d1soia_ first appeared in SCOP 1.67
  
• d1soia_ appears in SCOPe 2.03
  
• d1soia_ appears in SCOPe 2.05
  
• d1soia_ appears in the current release, SCOPe 2.08