Lineage for d1soia_ (1soi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971556Protein Hypothetical protein DR1025 [103209] (1 species)
  7. 2971557Species Deinococcus radiodurans [TaxId:1299] [103210] (4 PDB entries)
  8. 2971563Domain d1soia_: 1soi A: [98941]
    complexed with sm

Details for d1soia_

PDB Entry: 1soi (more details), 1.8 Å

PDB Description: crystal structure of nudix hydrolase dr1025 in complex with sm+3
PDB Compounds: (A:) MutT/nudix family protein

SCOPe Domain Sequences for d1soia_:

Sequence, based on SEQRES records: (download)

>d1soia_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
ehderthvpvelraagvvllnergdillvqekgipghpekaglwhipsgavedgenpqda
avreaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasf
vsredfaqlyaagqirmyqtklfyadalrekgfpalpv

Sequence, based on observed residues (ATOM records): (download)

>d1soia_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]}
ehderthvpvelraagvvllnergdillvqekgihpekaglwhipsgavedgenpqdaav
reaceetglrvrpvkflgaylgrfpdgvlilrhvwlaepepgqtlapaftdeiaeasfvs
redfaqlyaagqirmyqtklfyadalrekgfpalpv

SCOPe Domain Coordinates for d1soia_:

Click to download the PDB-style file with coordinates for d1soia_.
(The format of our PDB-style files is described here.)

Timeline for d1soia_: