SCOPe 2.04: Domain d1sm8b_: 1sm8 B:

Lineage for d1sm8b_ (1sm8 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)

8. Domain d1sm8b_: 1sm8 B: [98918]
   complexed with cr, dut, no3, trs

Details for d1sm8b_

PDB Entry: 1sm8, 2.9 Å

PDB Description: M. tuberculosis dUTPase complexed with chromium and dUTP

PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1sm8b_:

Sequence; same for both SEQRES and ATOM records:

>d1sm8b_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
hmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvg
lvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrv
elvelvevssfdeagla

Timeline for d1sm8b_:

• d1sm8b_ first appeared in SCOP 1.67
  
• d1sm8b_ appears in SCOPe 2.03
  
• d1sm8b_ appears in SCOPe 2.05
  
• d1sm8b_ appears in the current release, SCOPe 2.08, called d1sm8b1