SCOPe 2.02: Domain d1shtx_: 1sht X:

Lineage for d1shtx_ (1sht X:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein Capillary morphogenesis protein 2 domain [102543] (1 species)
   Anthrax toxin receptor 2

7. Species Human (Homo sapiens) [TaxId:9606] [102544] (3 PDB entries)
   Uniprot P58335 41-210

8. Domain d1shtx_: 1sht X: [98881]
   complexed with act, mg

Details for d1shtx_

PDB Entry: 1sht, 1.81 Å

PDB Description: Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor

PDB Compounds: (X:) Anthrax toxin receptor 2

SCOPe Domain Sequences for d1shtx_:

Sequence; same for both SEQRES and ATOM records:

>d1shtx_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]}
rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg
kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae
keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaqs

Timeline for d1shtx_:

• d1shtx_ first appeared in SCOP 1.67
  
• d1shtx_ appears in SCOPe 2.01
  
• d1shtx_ appears in SCOPe 2.03
  
• d1shtx_ appears in the current release, SCOPe 2.08