Lineage for d1shtx_ (1sht X:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399192Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 399193Superfamily c.62.1: vWA-like [53300] (4 families) (S)
  5. 399194Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 399195Protein Capillary morphogenesis protein 2 domain [102543] (1 species)
    Anthrax toxin receptor 2
  7. 399196Species Human (Homo sapiens) [TaxId:9606] [102544] (2 PDB entries)
  8. 399198Domain d1shtx_: 1sht X: [98881]
    complexed with act, mg

Details for d1shtx_

PDB Entry: 1sht (more details), 1.81 Å

PDB Description: Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor

SCOP Domain Sequences for d1shtx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shtx_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens)}
rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg
kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae
keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgiinsilaqs

SCOP Domain Coordinates for d1shtx_:

Click to download the PDB-style file with coordinates for d1shtx_.
(The format of our PDB-style files is described here.)

Timeline for d1shtx_: