Lineage for d1sd6a_ (1sd6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307472Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. 2307477Protein Methicillin resistance regulatory protein MecI [101017] (1 species)
  7. 2307478Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries)
  8. 2307485Domain d1sd6a_: 1sd6 A: [98803]

Details for d1sd6a_

PDB Entry: 1sd6 (more details), 2.65 Å

PDB Description: crystal structure of native meci at 2.65 a
PDB Compounds: (A:) Methicillin resistance regulatory protein mecI

SCOPe Domain Sequences for d1sd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sd6a_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn
kifqyyslveesdikyktsknfinkvykggfnslvlnfvekeelsqdeieelrnilnkk

SCOPe Domain Coordinates for d1sd6a_:

Click to download the PDB-style file with coordinates for d1sd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1sd6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sd6b_