![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.39: Penicillinase repressor [101016] (2 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain |
![]() | Protein Methicillin resistance regulatory protein MecI [101017] (1 species) |
![]() | Species Staphyloccocus aureus [101018] (4 PDB entries) |
![]() | Domain d1sd6a_: 1sd6 A: [98803] |
PDB Entry: 1sd6 (more details), 2.65 Å
SCOP Domain Sequences for d1sd6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sd6a_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphyloccocus aureus} tyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidrkkdn kifqyyslveesdikyktsknfinkvykggfnslvlnfvekeelsqdeieelrnilnkk
Timeline for d1sd6a_: