SCOP 1.73: Domain d1sa1d2: 1sa1 D:246-437

Lineage for d1sa1d2 (1sa1 D:246-437)

Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
Protein Tubulin beta-subunit [55313] (2 species)
Species Cow (Bos taurus) [TaxId:9913] [64322] (6 PDB entries)
Domain d1sa1d2: 1sa1 D:246-437 [98785]
Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b1, d1sa1c1, d1sa1c2, d1sa1d1, d1sa1e_
complexed with gdp, gtp, mg, pod

Details for d1sa1d2

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex

PDB Compounds: (D:) Tubulin beta chain

SCOP Domain Sequences for d1sa1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa1d2 d.79.2.1 (D:246-437) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

SCOP Domain Coordinates for d1sa1d2:

Click to download the PDB-style file with coordinates for d1sa1d2.
(The format of our PDB-style files is described here.)

Timeline for d1sa1d2: