Lineage for d1sa1a1 (1sa1 A:2-245)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694479Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 694480Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 694481Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 694514Protein Tubulin alpha-subunit [52494] (2 species)
  7. 694515Species Cow (Bos taurus) [TaxId:9913] [63989] (3 PDB entries)
  8. 694519Domain d1sa1a1: 1sa1 A:2-245 [98778]
    Other proteins in same PDB: d1sa1a2, d1sa1b1, d1sa1b2, d1sa1c2, d1sa1d1, d1sa1d2, d1sa1e_

Details for d1sa1a1

PDB Entry: 1sa1 (more details), 4.2 Å

PDB Description: Tubulin-podophyllotoxin: stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOP Domain Sequences for d1sa1a1:

Sequence, based on SEQRES records: (download)

>d1sa1a1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d1sa1a1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdgddsfntffsetgagkhvprav
fvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkla
dqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepyn
siltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfd

SCOP Domain Coordinates for d1sa1a1:

Click to download the PDB-style file with coordinates for d1sa1a1.
(The format of our PDB-style files is described here.)

Timeline for d1sa1a1: