![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin/Dihydroxyacetone kinase C-terminal domain [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins) |
![]() | Protein Tubulin beta-subunit [55313] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [64322] (3 PDB entries) |
![]() | Domain d1sa1d2: 1sa1 D:246-437 [98785] Other proteins in same PDB: d1sa1a1, d1sa1a2, d1sa1b1, d1sa1c1, d1sa1c2, d1sa1d1, d1sa1e_ complexed with gdp, gtp, mg, pod |
PDB Entry: 1sa1 (more details), 4.2 Å
SCOP Domain Sequences for d1sa1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sa1d2 d.79.2.1 (D:246-437) Tubulin beta-subunit {Cow (Bos taurus)} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqd
Timeline for d1sa1d2: