SCOPe 2.08: Domain d1sa0e1: 1sa0 E:5-141

Lineage for d1sa0e1 (1sa0 E:5-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d1sa0e1: 1sa0 E:5-141 [98777]
   Other proteins in same PDB: d1sa0a1, d1sa0a2, d1sa0b1, d1sa0b2, d1sa0c1, d1sa0c2, d1sa0d1, d1sa0d2, d1sa0e2
   complexed with cn2, gdp, gtp, mg

Details for d1sa0e1

PDB Entry: 1sa0, 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex

PDB Compounds: (E:) Stathmin 4

SCOPe Domain Sequences for d1sa0e1:

Sequence, based on SEQRES records:

>d1sa0e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyq
eaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlq
ekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d1sa0e1 a.137.10.1 (E:5-141) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dmevielnkctsgqsfevilkppsfdpsleeiqkkleaaeerrkyqeaellkhlaekreh
ereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknke
lke

Timeline for d1sa0e1:

• d1sa0e1 first appeared in SCOP 1.67, called d1sa0e_
  
• d1sa0e1 appears in SCOPe 2.07