Lineage for d1sa0a1 (1sa0 A:2-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107741Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2107819Protein Tubulin alpha-subunit [52494] (3 species)
  7. 2107820Species Cow (Bos taurus) [TaxId:9913] [63989] (4 PDB entries)
  8. 2107822Domain d1sa0a1: 1sa0 A:2-245 [98769]
    Other proteins in same PDB: d1sa0a2, d1sa0b1, d1sa0b2, d1sa0c2, d1sa0d1, d1sa0d2, d1sa0e1, d1sa0e2
    complexed with cn2, gdp, gtp, mg

Details for d1sa0a1

PDB Entry: 1sa0 (more details), 3.58 Å

PDB Description: tubulin-colchicine: stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d1sa0a1:

Sequence, based on SEQRES records: (download)

>d1sa0a1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagkh
vpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldr
irkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstav
vepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitas
lrfd

Sequence, based on observed residues (ATOM records): (download)

>d1sa0a1 c.32.1.1 (A:2-245) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
recisihvgqagvqignacwelyclehgiqpdgqmpdsfntffsetgagkhvpravfvdl
eptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvldrirkladqct
glqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvstavvepynsilt
thttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssitaslrfd

SCOPe Domain Coordinates for d1sa0a1:

Click to download the PDB-style file with coordinates for d1sa0a1.
(The format of our PDB-style files is described here.)

Timeline for d1sa0a1: