Lineage for d1s5yc_ (1s5y C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686315Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46495] (12 PDB entries)
  8. 2686332Domain d1s5yc_: 1s5y C: [98589]
    Other proteins in same PDB: d1s5yb_, d1s5yd_
    complexed with hem

Details for d1s5yc_

PDB Entry: 1s5y (more details), 2.5 Å

PDB Description: the crystal structure of trematomus bernacchii hemoglobin oxidized by ferricyanide
PDB Compounds: (C:) hemoglobin alpha chain

SCOPe Domain Sequences for d1s5yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5yc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d1s5yc_:

Click to download the PDB-style file with coordinates for d1s5yc_.
(The format of our PDB-style files is described here.)

Timeline for d1s5yc_: