SCOPe 2.02: Domain d1s5ug_: 1s5u G:

Lineage for d1s5ug_ (1s5u G:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical protein YbgC [102901] (1 species)

7. Species Escherichia coli [TaxId:562] [102902] (1 PDB entry)

8. Domain d1s5ug_: 1s5u G: [98579]
   structural genomics
   complexed with edo, so4

Details for d1s5ug_

PDB Entry: 1s5u, 1.7 Å

PDB Description: Crystal Structure of Hypothetical Protein EC709 from Escherichia coli

PDB Compounds: (G:) Protein ybgC

SCOPe Domain Sequences for d1s5ug_:

Sequence; same for both SEQRES and ATOM records:

>d1s5ug_ d.38.1.1 (G:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}
ttlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkm
tveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpr
alpksivaef

Timeline for d1s5ug_:

• d1s5ug_ first appeared in SCOP 1.67
  
• d1s5ug_ appears in SCOPe 2.01
  
• d1s5ug_ appears in SCOPe 2.03
  
• d1s5ug_ appears in the current release, SCOPe 2.08