![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (4 proteins) |
![]() | Protein Hypothetical protein YbgC [102901] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102902] (1 PDB entry) |
![]() | Domain d1s5ug_: 1s5u G: [98579] |
PDB Entry: 1s5u (more details), 1.7 Å
SCOP Domain Sequences for d1s5ug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5ug_ d.38.1.1 (G:) Hypothetical protein YbgC {Escherichia coli} ttlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkm tveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpr alpksivaef
Timeline for d1s5ug_: