Lineage for d1s5ua_ (1s5u A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721378Family d.38.1.1: 4HBT-like [54638] (16 proteins)
    Pfam PF03061
  6. 721423Protein Hypothetical protein YbgC [102901] (1 species)
  7. 721424Species Escherichia coli [TaxId:562] [102902] (1 PDB entry)
  8. 721425Domain d1s5ua_: 1s5u A: [98573]

Details for d1s5ua_

PDB Entry: 1s5u (more details), 1.7 Å

PDB Description: Crystal Structure of Hypothetical Protein EC709 from Escherichia coli
PDB Compounds: (A:) Protein ybgC

SCOP Domain Sequences for d1s5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}
tlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmt
veyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpra
lpksivaef

SCOP Domain Coordinates for d1s5ua_:

Click to download the PDB-style file with coordinates for d1s5ua_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ua_: