SCOP 1.71: Domain d1s5ua_: 1s5u A:

Lineage for d1s5ua_ (1s5u A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families)

5. Family d.38.1.1: 4HBT-like [54638] (5 proteins)
   Pfam 03061

6. Protein Hypothetical protein YbgC [102901] (1 species)

7. Species Escherichia coli [TaxId:562] [102902] (1 PDB entry)

8. Domain d1s5ua_: 1s5u A: [98573]

Details for d1s5ua_

PDB Entry: 1s5u, 1.7 Å

PDB Description: Crystal Structure of Hypothetical Protein EC709 from Escherichia coli

SCOP Domain Sequences for d1s5ua_:

Sequence; same for both SEQRES and ATOM records:

>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli}
tlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmt
veyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpra
lpksivaef

Timeline for d1s5ua_:

• d1s5ua_ first appeared in SCOP 1.67
  
• d1s5ua_ appears in SCOP 1.69
  
• d1s5ua_ appears in SCOP 1.73
  
• d1s5ua_ appears in the current release, SCOPe 2.08