Lineage for d1s5pa_ (1s5p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107555Protein NAD-dependent deacetylase CobB [102292] (1 species)
  7. 2107556Species Escherichia coli [TaxId:562] [102293] (1 PDB entry)
  8. 2107557Domain d1s5pa_: 1s5p A: [98569]
    complex with a acetylated substrate peptide, chain B
    complexed with zn

Details for d1s5pa_

PDB Entry: 1s5p (more details), 1.96 Å

PDB Description: Structure and substrate binding properties of cobB, a Sir2 homolog protein deacetylase from Eschericia coli.
PDB Compounds: (A:) NAD-dependent deacetylase

SCOPe Domain Sequences for d1s5pa_:

Sequence, based on SEQRES records: (download)

>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]}
kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
qvldwtgdvtpedkchccqfpaplrphvvwfgemplgmdeiymalsmadifiaigtsghv
ypaagfvheaklhgahtvelnlepsqvgnefaekyygpasqvvpefvekllkglk

Sequence, based on observed residues (ATOM records): (download)

>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]}
kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
qvldwtgdvtpedkcplrphvvwfgemplgmdeiymalsmadifiaigtsghvypaagfv
heaklhgahtvelnlepsqefaekyygpasqvvpefvekllkglk

SCOPe Domain Coordinates for d1s5pa_:

Click to download the PDB-style file with coordinates for d1s5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1s5pa_: