SCOPe 2.08: Domain d1s5pa_: 1s5p A:

Lineage for d1s5pa_ (1s5p A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
   silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain

6. Protein NAD-dependent deacetylase CobB [102292] (1 species)

7. Species Escherichia coli [TaxId:562] [102293] (1 PDB entry)

8. Domain d1s5pa_: 1s5p A: [98569]
   complex with a acetylated substrate peptide, chain B
   complexed with zn

Details for d1s5pa_

PDB Entry: 1s5p, 1.96 Å

PDB Description: Structure and substrate binding properties of cobB, a Sir2 homolog protein deacetylase from Eschericia coli.

PDB Compounds: (A:) NAD-dependent deacetylase

SCOPe Domain Sequences for d1s5pa_:

Sequence, based on SEQRES records:

>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]}
kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
qvldwtgdvtpedkchccqfpaplrphvvwfgemplgmdeiymalsmadifiaigtsghv
ypaagfvheaklhgahtvelnlepsqvgnefaekyygpasqvvpefvekllkglk

Sequence, based on observed residues (ATOM records):

>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]}
kprvlvltgagisaesgirtfraadglweehrvedvatpegfdrdpelvqafynarrrql
qqpeiqpnaahlalaklqdalgdrfllvtqnidnlheragntnvihmhgellkvrcsqsg
qvldwtgdvtpedkcplrphvvwfgemplgmdeiymalsmadifiaigtsghvypaagfv
heaklhgahtvelnlepsqefaekyygpasqvvpefvekllkglk

Timeline for d1s5pa_:

• d1s5pa_ first appeared in SCOP 1.67
  
• d1s5pa_ appears in SCOPe 2.07