SCOPe 2.08: Domain d1s4za1: 1s4z A:104-176

Lineage for d1s4za1 (1s4z A:104-176)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Heterochromatin protein 1, HP1 [54166] (4 species)
   duplication: consists of two homologous domains, N-terminal chromo domain and C-terminal chromo shadow domain

7. Species Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId:10090] [54167] (4 PDB entries)

8. Domain d1s4za1: 1s4z A:104-176 [98515]
   Other proteins in same PDB: d1s4za2, d1s4zb2
   Chromo shadow domain complexed with pxvxl motif peptide of caf-1, chain C

Details for d1s4za1

PDB Entry: 1s4z

PDB Description: hp1 chromo shadow domain in complex with pxvxl motif of caf-1

PDB Compounds: (A:) chromobox protein homolog 1

SCOPe Domain Sequences for d1s4za1:

Sequence; same for both SEQRES and ATOM records:

>d1s4za1 b.34.13.2 (A:104-176) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]}
keesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvisf
yeerltwhsypsd

Timeline for d1s4za1:

• d1s4za1 first appeared in SCOP 1.67, called d1s4za_
  
• d1s4za1 appears in SCOPe 2.07