PDB entry 1s4z

View 1s4z on RCSB PDB site
Description: HP1 chromo shadow domain in complex with PXVXL motif of CAF-1
Class: gene regulation
Keywords: gene regulation
Deposited on 2004-01-19, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromobox protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23197 (2-74)
      • cloning artifact (0-1)
      • engineered (74)
    Domains in SCOPe 2.08: d1s4za1, d1s4za2
  • Chain 'B':
    Compound: chromobox protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23197 (2-74)
      • cloning artifact (0-1)
      • engineered (74)
    Domains in SCOPe 2.08: d1s4zb1, d1s4zb2
  • Chain 'C':
    Compound: Chromatin assembly factor 1 subunit A
    Species: Mus musculus [TaxId:10090]
    Gene: CHAF1A, CAIP150
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QWF0 (1-29)
      • cloning artifact (0)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s4zA (A:)
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwhsypsd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s4zB (B:)
hmkeesekprgfargleperiigatdssgelmflmkwknsdeadlvpakeanvkcpqvvi
sfyeerltwhsypsd

  • Chain 'C':
    No sequence available.