SCOPe 2.08: Domain d1s35a1: 1s35 A:1063-1168

Lineage for d1s35a1 (1s35 A:1063-1168)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.1: Spectrin repeat [46966] (2 families)

5. Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
   this is a repeat family; one repeat unit is 1hci A:512-632 found in domain

6. Protein Spectrin beta chain [101078] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101079] (1 PDB entry)

8. Domain d1s35a1: 1s35 A:1063-1168 [98420]
   complexed with so4

Details for d1s35a1

PDB Entry: 1s35, 2.4 Å

PDB Description: crystal structure of repeats 8 and 9 of human erythroid spectrin

PDB Compounds: (A:) Spectrin beta chain, erythrocyte

SCOPe Domain Sequences for d1s35a1:

Sequence; same for both SEQRES and ATOM records:

>d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}
eqaflqdlddfqawlsitqkavasedmpeslpeaeqllqqhagikdeidghqdsyqrvke
sgekviqgqtdpeylllgqrlegldtgwdalgrmwesrshtlaqcl

Timeline for d1s35a1:

• d1s35a1 first appeared in SCOP 1.67
  
• d1s35a1 appears in SCOPe 2.07