Lineage for d1s35a2 (1s35 A:1169-1273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696504Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2696505Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 2696544Protein Spectrin beta chain [101078] (1 species)
  7. 2696545Species Human (Homo sapiens) [TaxId:9606] [101079] (1 PDB entry)
  8. 2696547Domain d1s35a2: 1s35 A:1169-1273 [98421]
    complexed with so4

Details for d1s35a2

PDB Entry: 1s35 (more details), 2.4 Å

PDB Description: crystal structure of repeats 8 and 9 of human erythroid spectrin
PDB Compounds: (A:) Spectrin beta chain, erythrocyte

SCOPe Domain Sequences for d1s35a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}
gfqefqkdakqaeailsnqeytlahleppdsleaaeagirkfedflgsmennrdkvlspv
dsgnklvaegnlysdkikekvqliedrhrknnekaqeasvllrdn

SCOPe Domain Coordinates for d1s35a2:

Click to download the PDB-style file with coordinates for d1s35a2.
(The format of our PDB-style files is described here.)

Timeline for d1s35a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s35a1