Lineage for d1s35a2 (1s35 A:1169-1273)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down
Superfamily a.7.1: Spectrin repeat [46966] (2 families) 
Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
Protein Spectrin beta chain [101078] (1 species) Species Human (Homo sapiens) [TaxId:9606] [101079] (1 PDB entry) 
Domain d1s35a2: 1s35 A:1169-1273 [98421]
complexed with so4
Details for d1s35a2
PDB Entry: 1s35 (more details), 2.4 Å
PDB Description: crystal structure of repeats 8 and 9 of human erythroid spectrin
PDB Compounds: (A:) Spectrin beta chain, erythrocyteSCOPe Domain Sequences for d1s35a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]}
gfqefqkdakqaeailsnqeytlahleppdsleaaeagirkfedflgsmennrdkvlspv
dsgnklvaegnlysdkikekvqliedrhrknnekaqeasvllrdn
SCOPe Domain Coordinates for d1s35a2:
Click to download the PDB-style file with coordinates for d1s35a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s35a2:
- d1s35a2 first appeared in SCOP 1.67
- d1s35a2 appears in SCOPe 2.07
View in 3D
