![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.1: Spectrin repeat [46966] (2 families) ![]() |
![]() | Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
![]() | Protein Spectrin beta chain [101078] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101079] (1 PDB entry) |
![]() | Domain d1s35a2: 1s35 A:1169-1273 [98421] complexed with so4 |
PDB Entry: 1s35 (more details), 2.4 Å
SCOPe Domain Sequences for d1s35a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} gfqefqkdakqaeailsnqeytlahleppdsleaaeagirkfedflgsmennrdkvlspv dsgnklvaegnlysdkikekvqliedrhrknnekaqeasvllrdn
Timeline for d1s35a2: