Lineage for d1s32g_ (1s32 G:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637444Protein Histone H2A [47115] (5 species)
  7. 637445Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (20 PDB entries)
  8. 637449Domain d1s32g_: 1s32 G: [98418]
    Other proteins in same PDB: d1s32a_, d1s32b_, d1s32d_, d1s32e_, d1s32f_, d1s32h_
    complexed with abu, bal, cl, dib, imt, mn, ogg, pyb

Details for d1s32g_

PDB Entry: 1s32 (more details), 2.05 Å

PDB Description: molecular recognition of the nucleosomal 'supergroove'
PDB Compounds: (G:) histone h2a

SCOP Domain Sequences for d1s32g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s32g_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk

SCOP Domain Coordinates for d1s32g_:

Click to download the PDB-style file with coordinates for d1s32g_.
(The format of our PDB-style files is described here.)

Timeline for d1s32g_: