SCOPe 2.01: Domain d1s2pa_: 1s2p A:

Lineage for d1s2pa_ (1s2p A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Alpha-crustacyanin [63807] (1 species)

7. Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries)

8. Domain d1s2pa_: 1s2p A: [98393]
   C2 subunit
   complexed with mpd, so4

Details for d1s2pa_

PDB Entry: 1s2p, 1.3 Å

PDB Description: the structure and refinement of apocrustacyanin c2 to 1.3a resolution and the search for differences between this protein and the homologous apoproteins a1 and c1

PDB Compounds: (A:) Crustacyanin C2 subunit

SCOPe Domain Sequences for d1s2pa_:

Sequence; same for both SEQRES and ATOM records:

>d1s2pa_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}
kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk
qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc
idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktl

Timeline for d1s2pa_:

• d1s2pa_ first appeared in SCOP 1.67
  
• d1s2pa_ appears in SCOP 1.75
  
• d1s2pa_ appears in SCOPe 2.02
  
• d1s2pa_ appears in the current release, SCOPe 2.08