Lineage for d1s16a1 (1s16 A:1217-1383)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537433Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 2537466Protein Topoisomerase IV subunit B [102753] (1 species)
  7. 2537467Species Escherichia coli [TaxId:562] [102754] (1 PDB entry)
  8. 2537468Domain d1s16a1: 1s16 A:1217-1383 [98331]
    Other proteins in same PDB: d1s16a2, d1s16b2
    complexed with anp, mg, so4

Details for d1s16a1

PDB Entry: 1s16 (more details), 2.1 Å

PDB Description: Crystal Structure of E. coli Topoisomerase IV ParE 43kDa subunit complexed with ADPNP
PDB Compounds: (A:) Topoisomerase IV subunit B

SCOPe Domain Sequences for d1s16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s16a1 d.14.1.3 (A:1217-1383) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]}
dglndylaeavnglptlpekpfignfagdteavdwallwlpeggelltesyvnliptmqg
gthvnglrqglldamrefceyrnilprgvklsaediwdrcayvlsvkmqdpqfagqtker
lssrqcaafvsgvvkdafilwlnqnvqaaellaemaissaqrrmraa

SCOPe Domain Coordinates for d1s16a1:

Click to download the PDB-style file with coordinates for d1s16a1.
(The format of our PDB-style files is described here.)

Timeline for d1s16a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s16a2