SCOP 1.67: Domain d1s16a1: 1s16 A:1217-1383

Lineage for d1s16a1 (1s16 A:1217-1383)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)

6. Protein Topoisomerase IV subunit B [102753] (1 species)

7. Species Escherichia coli [TaxId:562] [102754] (1 PDB entry)

8. Domain d1s16a1: 1s16 A:1217-1383 [98331]
   Other proteins in same PDB: d1s16a2, d1s16b2

Details for d1s16a1

PDB Entry: 1s16, 2.1 Å

PDB Description: Crystal Structure of E. coli Topoisomerase IV ParE 43kDa subunit complexed with ADPNP

SCOP Domain Sequences for d1s16a1:

Sequence; same for both SEQRES and ATOM records:

>d1s16a1 d.14.1.3 (A:1217-1383) Topoisomerase IV subunit B {Escherichia coli}
dglndylaeavnglptlpekpfignfagdteavdwallwlpeggelltesyvnliptmqg
gthvnglrqglldamrefceyrnilprgvklsaediwdrcayvlsvkmqdpqfagqtker
lssrqcaafvsgvvkdafilwlnqnvqaaellaemaissaqrrmraa

Timeline for d1s16a1:

• d1s16a1 is new in SCOP 1.67
  
• d1s16a1 appears in SCOP 1.69
  
• d1s16a1 appears in the current release, SCOPe 2.08