Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (4 families) |
Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (4 proteins) dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers) |
Protein Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 [103094] (1 species) forms heterohexamer with beta-subunit |
Species Pseudomonas pavonaceae [TaxId:47881] [103095] (1 PDB entry) |
Domain d1s0ya_: 1s0y A: [98314] Other proteins in same PDB: d1s0yb_, d1s0yd_, d1s0yf_, d1s0yh_, d1s0yj_, d1s0yl_ |
PDB Entry: 1s0y (more details), 2.3 Å
SCOP Domain Sequences for d1s0ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae} pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy vp
Timeline for d1s0ya_: