PDB entry 1s0y

View 1s0y on RCSB PDB site
Description: the structure of trans-3-chloroacrylic acid dehalogenase, covalently inactivated by the mechanism-based inhibitor 3-bromopropiolate at 2.3 angstrom resolution
Deposited on 2004-01-05, released 2004-02-24
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s0ya_
  • Chain 'B':
    Domains in SCOP 1.67: d1s0yb_
  • Chain 'C':
    Domains in SCOP 1.67: d1s0yc_
  • Chain 'D':
    Domains in SCOP 1.67: d1s0yd_
  • Chain 'E':
    Domains in SCOP 1.67: d1s0ye_
  • Chain 'F':
    Domains in SCOP 1.67: d1s0yf_
  • Chain 'G':
    Domains in SCOP 1.67: d1s0yg_
  • Chain 'H':
    Domains in SCOP 1.67: d1s0yh_
  • Chain 'I':
    Domains in SCOP 1.67: d1s0yi_
  • Chain 'J':
    Domains in SCOP 1.67: d1s0yj_
  • Chain 'K':
    Domains in SCOP 1.67: d1s0yk_
  • Chain 'L':
    Domains in SCOP 1.67: d1s0yl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s0yA (A:)
    mpmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpd
    yvpgnandkaliaklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yA (A:)
    pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
    vp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s0yB (B:)
    mpfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrihge
    aastertpavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yB (B:)
    pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s0yC (C:)
    mpmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpd
    yvpgnandkaliaklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yC (C:)
    pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s0yD (D:)
    mpfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrihge
    aastertpavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yD (D:)
    pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s0yE (E:)
    mpmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpd
    yvpgnandkaliaklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yE (E:)
    pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
    v
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s0yF (F:)
    mpfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrihge
    aastertpavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yF (F:)
    pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrih
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s0yG (G:)
    mpmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpd
    yvpgnandkaliaklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yG (G:)
    pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
    vp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s0yH (H:)
    mpfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrihge
    aastertpavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yH (H:)
    pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgri
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s0yI (I:)
    mpmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpd
    yvpgnandkaliaklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yI (I:)
    pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
    vp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s0yJ (J:)
    mpfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrihge
    aastertpavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yJ (J:)
    pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1s0yK (K:)
    mpmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpd
    yvpgnandkaliaklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yK (K:)
    pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
    v
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s0yL (L:)
    mpfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrihge
    aastertpavs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0yL (L:)
    pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgr