![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (4 families) ![]() |
![]() | Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (4 proteins) dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers) |
![]() | Protein Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 [103096] (1 species) forms heterohexamer with alpha-subunit |
![]() | Species Pseudomonas pavonaceae [TaxId:47881] [103097] (1 PDB entry) |
![]() | Domain d1s0yj_: 1s0y J: [98323] Other proteins in same PDB: d1s0ya_, d1s0yc_, d1s0ye_, d1s0yg_, d1s0yi_, d1s0yk_ |
PDB Entry: 1s0y (more details), 2.3 Å
SCOP Domain Sequences for d1s0yj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0yj_ d.80.1.1 (J:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae} pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgr
Timeline for d1s0yj_: