Lineage for d1s00h1 (1s00 H:36-256)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126036Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1126037Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. 1126038Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 1126039Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1126040Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
    Uniprot P11846
  8. 1126068Domain d1s00h1: 1s00 H:36-256 [98246]
    Other proteins in same PDB: d1s00h2, d1s00l_, d1s00m_, d1s00r_, d1s00s_, d1s00t2
    complexed with bcl, bph, fe2, lda, spo, u10; mutant

Details for d1s00h1

PDB Entry: 1s00 (more details), 2.6 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-separated d+qaqb- state
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1s00h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s00h1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml

SCOPe Domain Coordinates for d1s00h1:

Click to download the PDB-style file with coordinates for d1s00h1.
(The format of our PDB-style files is described here.)

Timeline for d1s00h1: