![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (4 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
![]() | Protein Photosynthetic reaction centre [50348] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries) Uniprot P11846 |
![]() | Domain d1s00h1: 1s00 H:36-256 [98246] Other proteins in same PDB: d1s00h2, d1s00l_, d1s00m_, d1s00r_, d1s00s_, d1s00t2 complexed with bcl, bph, fe2, lda, spo, u10; mutant |
PDB Entry: 1s00 (more details), 2.6 Å
SCOPe Domain Sequences for d1s00h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s00h1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksvvaaml
Timeline for d1s00h1: