| Class b: All beta proteins [48724] (174 folds) |
| Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (4 families) ![]() |
| Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
| Protein Photosynthetic reaction centre [50348] (3 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries) Uniprot P11846 |
| Domain d1s00h1: 1s00 H:36-256 [98246] Other proteins in same PDB: d1s00h2, d1s00l_, d1s00m_, d1s00r_, d1s00s_, d1s00t2 complexed with bcl, bph, fe2, lda, spo, u10; mutant |
| PDB Entry: 1s00 (more details) PDB Description: photosynthetic reaction center double mutant from rhodobacte sphaeroides with asp l213 replaced with asn and arg m233 re with cys in the charge-separated d+qaqb- state
PDB Compounds: (H:) reaction center protein h chainSCOP Domain Sequences for d1s00h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s00h1 b.41.1.1 (H:36-256) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksvvaaml
SCOP Domain Coordinates for d1s00h1:
Click to download the PDB-style file with coordinates for d1s00h1. (The format of our PDB-style files is described here.)
Timeline for d1s00h1:
d1s00h1 appears in SCOP 1.75A | d1s00h1 (click for larger image) d1s00h1 in context of chain Domains from same chain: d1s00h2 d1s00h1 in context of PDB Domains from other chains: d1s00l_, d1s00m_, d1s00r_, d1s00s_, d1s00t1, d1s00t2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |