Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein GTPase-binding domain of the cell polarity protein par6 (Par-6B) [89315] (2 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101716] (3 PDB entries) Uniprot O97111 156-253; Cg5884-pa |
Domain d1rzxa_: 1rzx A: [98236] complexed with peptide, chain B |
PDB Entry: 1rzx (more details), 2.1 Å
SCOPe Domain Sequences for d1rzxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn devievngievagktldqvtdmmvanssnliitvkpan
Timeline for d1rzxa_: