SCOP 1.67: Domain d1rzxa_: 1rzx A:

Lineage for d1rzxa_ (1rzx A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (24 proteins)

6. Protein GTPase-binding domain of the cell polarity protein par6 (Par-6B) [89315] (2 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101716] (2 PDB entries)
   Cg5884-pa

8. Domain d1rzxa_: 1rzx A: [98236]
   complexed with peptide, chain B
   complexed with ace

Details for d1rzxa_

PDB Entry: 1rzx, 2.1 Å

PDB Description: Crystal Structure of a Par-6 PDZ-peptide Complex

SCOP Domain Sequences for d1rzxa_:

Sequence; same for both SEQRES and ATOM records:

>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster)}
ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn
devievngievagktldqvtdmmvanssnliitvkpan

Timeline for d1rzxa_:

• d1rzxa_ is new in SCOP 1.67
  
• d1rzxa_ appears in SCOP 1.69
  
• d1rzxa_ appears in the current release, SCOPe 2.08