Lineage for d1rzxa_ (1rzx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785948Protein GTPase-binding domain of the cell polarity protein par6 (Par-6B) [89315] (2 species)
  7. 2785949Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101716] (3 PDB entries)
    Uniprot O97111 156-253; Cg5884-pa
  8. 2785950Domain d1rzxa_: 1rzx A: [98236]
    complexed with peptide, chain B

Details for d1rzxa_

PDB Entry: 1rzx (more details), 2.1 Å

PDB Description: Crystal Structure of a Par-6 PDZ-peptide Complex
PDB Compounds: (A:) cg5884-pa

SCOPe Domain Sequences for d1rzxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn
devievngievagktldqvtdmmvanssnliitvkpan

SCOPe Domain Coordinates for d1rzxa_:

Click to download the PDB-style file with coordinates for d1rzxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rzxa_: