Lineage for d1rzqb1 (1rzq B:8-166)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771729Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. 2771730Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries)
  8. 2771771Domain d1rzqb1: 1rzq B:8-166 [98220]
    Other proteins in same PDB: d1rzqa2, d1rzqb2, d1rzqc2
    complexed with acy, cu, so4

Details for d1rzqb1

PDB Entry: 1rzq (more details), 2.2 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH5.0
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1rzqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzqb1 b.6.1.3 (B:8-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek

SCOPe Domain Coordinates for d1rzqb1:

Click to download the PDB-style file with coordinates for d1rzqb1.
(The format of our PDB-style files is described here.)

Timeline for d1rzqb1: