SCOPe 2.08: Domain d1rzqb2: 1rzq B:167-335

Lineage for d1rzqb2 (1rzq B:167-335)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)

7. Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries)

8. Domain d1rzqb2: 1rzq B:167-335 [98221]
   Other proteins in same PDB: d1rzqa1, d1rzqb1, d1rzqc1
   complexed with acy, cu, so4
   has additional insertions and/or extensions that are not grouped together

Details for d1rzqb2

PDB Entry: 1rzq, 2.2 Å

PDB Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH5.0

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1rzqb2:

Sequence; same for both SEQRES and ATOM records:

>d1rzqb2 b.6.1.3 (B:167-335) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvv

Timeline for d1rzqb2:

• d1rzqb2 first appeared in SCOP 1.67
  
• d1rzqb2 appears in SCOPe 2.07