Lineage for d1rzhl_ (1rzh L:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698958Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1698959Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1698960Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1698961Protein L (light) subunit [81477] (3 species)
  7. 1698962Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
    Uniprot P02954
  8. 1698963Domain d1rzhl_: 1rzh L: [98164]
    Other proteins in same PDB: d1rzhh1, d1rzhh2, d1rzhm_
    complexed with bcl, bph, cdl, fe2, gol, hto, lda, po4, spo, u10; mutant

Details for d1rzhl_

PDB Entry: 1rzh (more details), 1.8 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-neutral dqaqb state (trigonal form)
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1rzhl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzhl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhentffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1rzhl_:

Click to download the PDB-style file with coordinates for d1rzhl_.
(The format of our PDB-style files is described here.)

Timeline for d1rzhl_: