Lineage for d1rzhl_ (1rzh L:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426657Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 426658Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 426659Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 426660Protein L (light) subunit [81477] (3 species)
  7. 426661Species Rhodobacter sphaeroides [TaxId:1063] [81475] (38 PDB entries)
  8. 426662Domain d1rzhl_: 1rzh L: [98164]
    Other proteins in same PDB: d1rzhh1, d1rzhh2, d1rzhm_
    complexed with bcl, bph, cdl, fe2, gol, hto, lda, po4, spo, u10; mutant

Details for d1rzhl_

PDB Entry: 1rzh (more details), 1.8 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg m233 replaced with cys in the charge-neutral dqaqb state (trigonal form)

SCOP Domain Sequences for d1rzhl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzhl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhentffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1rzhl_:

Click to download the PDB-style file with coordinates for d1rzhl_.
(The format of our PDB-style files is described here.)

Timeline for d1rzhl_: