Lineage for d1ryva_ (1ryv A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240432Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 1240473Family g.3.6.2: Spider toxins [57072] (25 proteins)
  6. 1240500Protein Hainantoxin-IV [82881] (1 species)
  7. 1240501Species Spider (Selenocosmia hainana) [TaxId:209901] [82882] (3 PDB entries)
  8. 1240504Domain d1ryva_: 1ryv A: [98115]
    mutant

Details for d1ryva_

PDB Entry: 1ryv (more details)

PDB Description: three dimensional solution structure of the k27a mutant of sodium channels inhibitor hainantoxin-iv by 2d 1h-nmr
PDB Compounds: (A:) hainantoxin-IV

SCOPe Domain Sequences for d1ryva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryva_ g.3.6.2 (A:) Hainantoxin-IV {Spider (Selenocosmia hainana) [TaxId: 209901]}
eclgfgkgcnpsndqcckssnlvcsrahrwckyei

SCOPe Domain Coordinates for d1ryva_:

Click to download the PDB-style file with coordinates for d1ryva_.
(The format of our PDB-style files is described here.)

Timeline for d1ryva_: