Lineage for d1ryga_ (1ryg A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1061763Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 1061804Family g.3.6.2: Spider toxins [57072] (25 proteins)
  6. 1061831Protein Hainantoxin-IV [82881] (1 species)
  7. 1061832Species Spider (Selenocosmia hainana) [TaxId:209901] [82882] (3 PDB entries)
  8. 1061834Domain d1ryga_: 1ryg A: [98101]
    mutant

Details for d1ryga_

PDB Entry: 1ryg (more details)

PDB Description: three dimensional solution structure of the r29a mutant of sodium channels inhibitor hainantoxin-iv by 2d 1h-nmr
PDB Compounds: (A:) hainantoxin-IV

SCOPe Domain Sequences for d1ryga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryga_ g.3.6.2 (A:) Hainantoxin-IV {Spider (Selenocosmia hainana) [TaxId: 209901]}
eclgfgkgcnpsndqcckssnlvcsrkhawckyei

SCOPe Domain Coordinates for d1ryga_:

Click to download the PDB-style file with coordinates for d1ryga_.
(The format of our PDB-style files is described here.)

Timeline for d1ryga_: