Lineage for d1ryga_ (1ryg A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427455Superfamily g.3.6: omega toxin-like [57059] (4 families) (S)
  5. 427490Family g.3.6.2: Spider toxins [57072] (23 proteins)
  6. 427517Protein Hainantoxin-IV [82881] (1 species)
  7. 427518Species Chinese bird spider (Selenocosmia hainana) [82882] (3 PDB entries)
  8. 427520Domain d1ryga_: 1ryg A: [98101]
    complexed with nh2; mutant

Details for d1ryga_

PDB Entry: 1ryg (more details)

PDB Description: three dimensional solution structure of the r29a mutant of sodium channels inhibitor hainantoxin-iv by 2d 1h-nmr

SCOP Domain Sequences for d1ryga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ryga_ g.3.6.2 (A:) Hainantoxin-IV {Chinese bird spider (Selenocosmia hainana)}
eclgfgkgcnpsndqcckssnlvcsrkhawckyei

SCOP Domain Coordinates for d1ryga_:

Click to download the PDB-style file with coordinates for d1ryga_.
(The format of our PDB-style files is described here.)

Timeline for d1ryga_: